McDonnell Genome Institute

Washington University

CircRNA

chr1|171583955|171588505|+|PRRC2C|ENST00000338920.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.957

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

YSAHSYIV

Amino Acids from 5' Exons

ISASFYAKQFIPAICGPFWYCYSQLSNCPTPRTCQGTIRSCLSANIKYSAHSYIVTSTGAGIRTRRFPADHTSSP,SQPAFMQSSLSQPSVVLSGTAIHNFPTVQHQELAKAQSGLAFQQTSNTQPIPILYEHQLGQASGLGGSQLIDTHLLQ,LSQLLCKAVYPSHLWSFLVLLFTTFQLSNTKNLPRHNPVLPFSKHQILSPFLYCMNINWGRHQDEVPSLTHIFS

Amino Acids from 3' Exons

GYFYKSEQPVQQNEQHCLPEAVPVSPCHCENDTTISYTVCTP,ATSTSPNSQSSKMNSIVYQKQFQSAPATVRMTQPFPTQFAPQ,LLLQVRTASPAKTALSTRSSSSQPLPLEHNHFLHSLHP