McDonnell Genome Institute

Washington University

CircRNA

chr1|171512994|171523522|+|PRRC2C|ENST00000367742.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9694

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

RITVAARHGLQSLGK

Amino Acids from 5' Exons

LQLDMDYRVLEKSVFHGVCLHLLTSQVLKQKTKAMILMTLYLKMAQGGHQNKSNMKKK,CSSTWITESWKSRYFTAYASTCPPKSSRKQRQSCKHCTRWHRVGIKTRATRRK,AARHGLQSLGKVGISRRMPPPANLPSLKAENKGNDPNVNIVPKDGTGWASKQEQHEEE

Amino Acids from 3' Exons

VLRWKIIQSNISVMMMNKEVTVLKRIT,CSDGSRLYRATEFQTRKQSREQ,AQMEVDYTEQLNFSDDDEQGSNSPKENN