McDonnell Genome Institute

Washington University

CircRNA

chr1|170016461|170041840|-|KIFAP3|ENST00000538366.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9855

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

9

Peptide

LTALLDWEGSAGLLK

Amino Acids from 5' Exons

VEMDIVEKLVKMIPCEHEDLLNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALL,WKWILLKNWKYLVSMKTCISPSDFYTYPLTQDGIRWYKLDCFPSSLHS,GNGYCKTGENDTLARPAEYHPPTFTKPILHRTEEDGTSWTASQAHCTP

Amino Acids from 3' Exons

IGKGQQDFRGNTTFKEANRSGEGKRDVDCPWQHLPEKSFRFRNCFCTPSKLM,LGRVSRTSEEGTRPLRRPTDQEKAKGMSIALGNTYRRSLSDSETVSVLQASLCE,WEGSAGLLKREHDLGGQQIRRRQKGCRLPLATLTGEVFQIQKLFLYSKQAYVK