McDonnell Genome Institute

Washington University

CircRNA

chr1|169862612|169869039|-|SCYL3|ENST00000367770.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9873

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

VILPQFQR

Amino Acids from 5' Exons

IMRREKLLACSHQPCSSHGSPCFSSCLKFMKSMCGWCCCLTSRPTWSTSLRSSRKSSCH,SCAGRNSLLALTSPVPVTGDPRASPVVSSRACADGAAVSHRGLRGALHSGAAEESHLAT,HAQGETPCLLSPALFQSRVIPVLLQLFEVHEEHVRMVLLSHIEAYVEHFTQEQLKKVILPQ

Amino Acids from 3' Exons

FQRMFSPAFNRPCTQLCIPFQNVGQRSAPYYLMTSS,FSGCSLQLSTDLALNFAESHSKMSASALHLTISLLQ,SADVLSSFQQTLHSTLLNPIPKCRPALCTLLSHDFF