McDonnell Genome Institute

Washington University

CircRNA

chr1|16929845|16930594|+|CROCC|ENST00000375541.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.908

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

4

Peptide

GGAGAGSAAGAWGAGDAGAQGAGTAER

Amino Acids from 5' Exons

LEQALRLEPGELETQEPRGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGK,WSRLCGWSLGSWRRRSPGGWYGRAWSCGGSCRRSRPPTGASCRPTRRASSGRPSLCSGCRA,GAGSAAGAWGAGDAGAQGAGTAERGVAEAAAGGAGLLPAQAAGLPGGPAAAGPACAAAAGQ,LEQALRLEPGELETQEPRGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGK,WSRLCGWSLGSWRRRSPGGWYGRAWSCGGSCRRSRPPTGASCRPTRRASSGRPSLCSGCRA,GAGSAAGAWGAGDAGAQGAGTAERGVAEAAAGGAGLLPAQAAGLPGGPAAAGPACAAAAGQ

Amino Acids from 3' Exons

ECQPGPGECHAPRTAGPGRLGQPGSEGHTKGDQLDTLPQGAGAPGGGVEARGG,SASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEE,VPAWPRMPCSENSWTRQARPTRLVRTYERPMTGHAAARSWSTGRRRGGARR,ECQPGPGECHAPRTAGPGRLGQPGSEGHTKGDQLDTLPQGAGAPGGGVEARGG,SASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEE,VPAWPRMPCSENSWTRQARPTRLVRTYERPMTGHAAARSWSTGRRRGGARR