McDonnell Genome Institute

Washington University

CircRNA

chr1|169111369|169125039|+|ATP1B1|ENST00000367815.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9291

33

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

DDMIFEDCGVK

Amino Acids from 5' Exons

LRSFYSTYFMAAWLASSSEPSKCCSPSVNLSPHIRTEWPRQ,DPSILRNILWLPGWHLHRNHPSDAAHHQIAHISGPSGPA,KILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPP

Amino Acids from 3' Exons

DHRFLRSRRLKFPFVLMIPRAMRHMYTLGSWKSTKIQPRGMTFLKIVA,INTDSSDPEDNFLSSSQELGICTEHSVPGKVQRFSPEGHDFRLW,LTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCG