McDonnell Genome Institute

Washington University

CircRNA

chr1|168002481|168004793|+|DCAF6|ENST00000312263.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9316

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

HLDTTHIISLLR

Amino Acids from 5' Exons

LRQPPVKRLRLRGDWSDTGPRARPESERERD,CDNHQLSVDFVVIGQILDPEQGRRVNENEM,ATTTSAFETSWLVRYWTQSKAGETRTR

Amino Acids from 3' Exons

VEQVNQIFQLFLRSHQVLIWKVKLQWKILQLNNFFSLLHPLQCQLRLIRHHLPQKALILLLCYLLQTVNKGSLLRHLDTTHIISL,WNKSIRYFNSSYGPIKSFGSENCNGSRYSSTISSAFYILYNVSSGSFDIISHRKPSFYSFAIFSRQTKAVCGIWTPHTSSV,GTSQSDISTLPTVPSSPDLEVSETAMEVDTPAEQFLQPSTSSTMSAQAHSTSSPTESPHSTPLLSSPDSEQRQSVEASGHHTHHQS