McDonnell Genome Institute

Washington University

CircRNA

chr1|165679441|165683110|-|ALDH9A1|ENST00000354775.4

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.951

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

GALMANFLTQGQER

Amino Acids from 5' Exons

IMEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGALMANFLTQGQ,SWRCQLKESNLLPWNLEANLHSSSSQTVITMLRGRWPTSSHKA,HGDVSRNQTCYLGTWRQISTHHLLRLYEQCCKGGADGQLPHTRP

Amino Acids from 3' Exons

EREDEIATMECINNGKSIFEARLDIDISWQCLEYYAGLAASMA,NGRMKLLLWSASTMASPSLRPAWTLTFPGSAWSIMRAWLHPWL,TGGNCYYGVHQQWQVHLGPLGHHFLAVPGVLCGLGCIHG