McDonnell Genome Institute

Washington University

CircRNA

chr1|164799698|164812149|+|PBX1|ENST00000367897.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9213

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

QLSLLPMCQPMEAK

Amino Acids from 5' Exons

ACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDA,PATSSPPTISCESKAGPGPSPQRRLSGWSASSTASSAPSRCSSSRARARRSCVPDFWMR,LQRVHHPRDESPARAKPDQAHLPKGDADGQHHPPQVQLHPDAAQAEHVRGGDDPAFPISGCA

Amino Acids from 3' Exons

VSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSA,YQTGLEISESGTRRTVNFKRKPIFMLPKQLSLLPMCQPMEAKLTRPQLPTRL,IKLVWKANPVQEEHRISRGSQYLCCQNSCHCYQCVSPWKPSLALNSQLG