McDonnell Genome Institute

Washington University

CircRNA

chr1|1623430|1623945|+|MIB2|ENST00000502470.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9979

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

SSPTPSTATRPLTR

Amino Acids from 5' Exons

VPSSPAQHGPRPPGGRAGGHAGGARRGLEVGPAGRRRGRRGHGGGAWPPRQPLDTRPHSGRAVGPGHAHQLPRRLPGRARPAA,SRAAPPNMDPDPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLL,PEQPRPTWTQTPRRACRWACGWCAAWTGSGASRTAARAAWARWWSLAATAAPRHPTAQWSCSGTRARAPTTAPATRARTTCC

Amino Acids from 3' Exons

ASGTPTSSVTAARSTGCGGCAGSAVCAWTTTSARSATCTTSMSSPTPSTATRPLTRA,RPAPQHHLLLQEARAAGDALEVPCVPGLRPLHAVLHAQQAARPRLRPLRDRSLAP,VRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSR