McDonnell Genome Institute

Washington University

CircRNA

chr1|16133480|16135770|-|EPHA2|ENST00000358432.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9966

35

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

VIGAEPPK

Amino Acids from 5' Exons

NNSPRHTWTPTHMRTPTRLCSSLPRSIHPVSLGRRSEQ,TTEAPEDIRGPPHIGPQPGCVEVHYRDPSILCHSAEGDRS,QLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGA

Amino Acids from 3' Exons

SPPRGWRAAAPPRLASPGASPRRSRAECGSTRSLTAR,APQGEAGGPQHHLARLLEHPPAAAEPSVEVRGHLPQE,PPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKK