McDonnell Genome Institute

Washington University

CircRNA

chr1|160306353|160325652|-|COPA|ENST00000241704.7

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9387

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

TLSHSLTYSR

Amino Acids from 5' Exons

LLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK,FSRIRMRSPKRYRCPTVMRSSMLAQAISCFEMRTLSHSLTYSRS,SDQESEEDHQKGTGAQLDLLCWHRQSPASRCGLYHTLRTAEA

Amino Acids from 3' Exons

VGKKTCPLVRWNRMEELGLIYLELQMQWSMY,SEEKKPVPWCGGIGCERNNWGSIWNYRCSGEACTR,LRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLE