McDonnell Genome Institute

Washington University

CircRNA

chr1|160296060|160306493|-|COPA|ENST00000241704.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9665

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

ETFDPEKETLLIKNLK

Amino Acids from 5' Exons

SPWPISQLLPMAMKKLRARRHLTQRRR,VPGLSHSCYPWLRRSEPKGDIPREGD,SLAYLTAATHGLDEEAESLKETFDPEKET

Amino Acids from 3' Exons

LLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK,FSRIRMRSPKRYRCPTVMRSSMLAQAISCFEMRTLSHSLTYSRS,SDQESEEDHQKGTGAQLDLLCWHRQSPASRCGLYHTLRTAEA