McDonnell Genome Institute

Washington University

CircRNA

chr1|159919660|159920537|-|TAGLN2|ENST00000320307.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

2

Peptide

YGINTTDIFQTVDLWEAPR

Amino Acids from 5' Exons

VLCELINALYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWE,CYVSSLMHCTPRGRPQRRSRPPPWPSSRWSRSLSSCKQLSAMALTPLTSSKLWTSGK,AMAHCTVPRGAGPSKEDPGLHHGLQADGADLSVPASSALWHHHHLPNCGPLG

Amino Acids from 3' Exons

LPAATATHWNGQQGTCIWPEPGGAAEDETICRSGADPDPVDHHPVPKGCGPAPAWTRELPELAQGWH,SPQPPPPIGMANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGT,PRSHRHPLEWPTGDLHMAAGRCSRRLRNNMMQIWSRSSSGSPPSAERMWAGPSLDARTSRTGSRMA