McDonnell Genome Institute

Washington University

CircRNA

chr1|159032523|159053724|+|IFI16|ENST00000483916.2

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9862

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

STPSPFPQH

Amino Acids from 5' Exons

IKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTTFPESHLRTPQMPPTTPSSSFFTK,RKKQTRETMTPRASYPRNSVSFHILQRPAQPSLRAIFGLLRCHQQLHPAVSSP,KEKNKPEKQPQEHEATPGTASASISFRGQHNLPEPSSDSSDATNNSIQQFLHQ

Amino Acids from 3' Exons

LKPRLKTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKVSPHHCFIKFLLQPPIFKVLTCQLEFGQLTQHRKSTPSPFPQHRLNRVHFRIWGTLYCNIPLLKVSSCKLFRQSLGNLAFYFSIQSHPCPGQCRVYINTHILRILFLVLLHLYQQLNLIVNKRVALPSLNPDCDNQSKKNRLLCFRMQLCLTVSNSDHLDSKVSCLFSFINSSGDCRATNFCIKEKYEAKRLKKSRSLTAQFINGAIKCKKKKKSLVNSAYSVPFSLYTSCKYYALILLVSTVSYSIIHVFGGLLLIVLFSLHSVMTVHIYVVVELMNNELQTRTMLDRDDLDLRSGQIGKELYGEERSSYILKQSTGRATFFLKLTKCHKKPLFSALGQVKKPTKLIRFFCIQAPKIPAVLMWKQEELGKSIFFPRKNPADKELQQKRLKGGVERQDSKTKYLKLFGTCYSGPTALFTLSKTKVSRNTLYFSIKLLIQFQKISVNFLLQKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIK,NQDRLNLKKFPKTVPRVTSKKWCTQQNHLYMSPKSRRKCFMPQWQLRMKSSERFLILTRRSSPQRRSLPQIMFAAMGSWRYILSHLWLMMLTETWRSQKDLEVPALLKSISFAHKLKEVLMGCLRYIRAHTIVLNFSCNLQFLKSLVNWSLVNLLNTENQPLHPSPSTRDNIEFISGYGVRYIVTFLFLRYHHASYLDSHETWHFISFDDLFRATLVQDSAEFISTHISLGFCFFEFFSICINDNLILIKELLSQAILIVTTRVRNKIDYSALECSYVQLARILIIWTPKFLASSHSLIHQETVEQLTSALNNKRNTKQKDKSHVALLNLMGQNAKKRKKAWILRLTVCLSVSTHHVNIMLSFNFLFEVLFHTPLYMSSRVAYFLCCFLYTQFKLYIYMWLSIMSYKPEQCDIDRMIIDLGRLGKSDYMEKKEVVTYNNSLLNEDVQHSFSNLQSAIKSLYSLLLGRCERNLPNSDFSVSRLLKKSQLCCGNRKNESNQFFFLEKIQQTKNFNKRGSREELKGRIQRPSILSYLVPVIQDLQLCLLYQRQKFPETPCISHRFENYSSFRRVLIFFCRKMGVNSLIMKYKIIQGRWKWWCMDDPQSTVRKEINNSPALNWHRKVGIPGSDLFIVTS,ETKTEDTRSFHRRQCPEPQRSDGAERNRIICIAQRAEENVSCHSGNESLPSEGFYPKGEVHPKEDHCHSKLCLPQWVPGGISFHTCGCECPKHGDPKRIDKCQRNSNQSALLTNRKFCEWGVGTGKPTPLFYKISPATSNFSLNLSTGVWSTYSTQKINPFTLPPALEIIESSFQDMGYVILHSSSGIIMQVITVTRKLGILLVLMIYSEPPLSRTVQSLYQHTYPDFVSLSSSPSVSMTTFNCEKSCSPKPESLQPEEIKTTLLNAAMSNSLEFSFGLQSFLPLLIHFIRRLSNLLHIIREIRSKKTKKVTLNCSIYKWGNKMQKKEKKLGEFLGLQCAFQSLHIMILCLADLTSCLKYCFILHYTCLLGWLTFNCAVFSTLSLNDCTYICGCRVNEATNQNNVTRIGSRFEIWADWERVTIWRRKKLHIEITVYLMRTCNILSQTYKVPKASILCSWAGVKETYQINQIFLYPGSLKNPSCADVETGRIRKVINFFSKKSSRQRTSTKEAQGRSKAGFKDQVSAIWYLLFRTYSSVYSIKDKSFQKHPVFLIDLKIIDPVSEDKCFSFAEKCKGIHLLNTRYREDGSGGAWTTDHNQLGRRTETHLLIGTEKWEYRGVEICNSSHQ