McDonnell Genome Institute

Washington University

CircRNA

chr1|158669407|158683496|-|SPTA1|ENST00000368147.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9932

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

LADDEDYKGK

Amino Acids from 5' Exons

LLARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINKKKKLADDEDYK,CPGGMPYVKRLPLDVDCRSHCFCKNCMRTQMTRTGSTRRKSWQMMKIT,VSPAGCPTKGCHTIAEGVIASAKTVGLRPKELDQQEEKVGRRLQ

Amino Acids from 3' Exons

GKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETK,GNIRSINPLKQRCKQNQDSCLNWKKQGKNDLPWVILPTKKR,EISEASIPSRGANKIKTHVTGKNKGRTIYHGSFCPRRNE