McDonnell Genome Institute

Washington University

CircRNA

chr1|158635912|158654748|-|SPTA1|ENST00000368147.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9991

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

GSWLYMTSRPAAPEK

Amino Acids from 5' Exons

NVLDMAEKLKDKAAVGQEEIQLRLAQFVEHWEKLKELAKA,MCWIWQRSKTRLLWGKRRSSCGWLSLLNTGRSSKSWPRP,CAGYGREAERQGCCGARGDPVAAGSVCTLGEAQRVGQGP

Amino Acids from 3' Exons

QQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINK,NNRLHQWRELLENKGSWLYMTSRPAAPEKSPRKVMSRCSVPSI,TTGCTSGGSCWRTKGHGFILPGPQPPRSHHEERCLNAAQFHQ