McDonnell Genome Institute

Washington University

CircRNA

chr1|156943934|156945197|-|ARHGEF11|ENST00000361409.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9951

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

SVATGGTSEHEK

Amino Acids from 5' Exons

TSTCCCWRTSCCYRNRMRSYCSATARLLWAPQTASRPSAPCSSSMLCSSALWPQ,PPRAAAGGPPSAATETGEAIAEVPQQDCCGLLRQQADLQPRAQAQCCAHPLCGH,LHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVAT

Amino Acids from 3' Exons

VAPLSMRSCAGPGTSAGRFSSMMKRNKQRTATVRATRNAWMPPPWRGPATPWQQSS,WHLAEAVPGPGPVPGDSQVCESGKTNREPPPFRGLPETPGCHRPGEGQQPPGSRVQ,GTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFK