McDonnell Genome Institute

Washington University

CircRNA

chr1|156744162|156745146|-|HDGF|ENST00000357325.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9011

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

12

Peptide

RAGDLLEGIPGPQRPLPLR

Amino Acids from 5' Exons

SSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNEKGALKRRAGDLLE,PPRKRAVWKSLNQSPKLQRVTVIRRGMQRAAATRKGSWSLMSQPRRRTRKERRGEQGTCW,LPEKELCGRATRARSCRGREGECRGQQRRGREAGHASQGEERERSVEEESRGLAG

Amino Acids from 3' Exons

GIPGPQRPLPLRGIQGEVWQAQQEERVQRGAVGDREQPYCQGFRLS,AFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQ,HSWAPKTSSLTRNPRRSLASPTRGKGSARGCGRSRTTLLSRLPAI