McDonnell Genome Institute

Washington University

CircRNA

chr1|156743651|156743878|-|HDGF|ENST00000357325.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

12

Peptide

EDAEAPGIRDHER

Amino Acids from 5' Exons

DSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHE,TLLNVPRRQKTLKERRRRQPPWRLRGPFLWRWKRIAPPLSPALAGGLPKRKKRRRMKRKRLPRKMLRPQASEIMR,LSTSQGGRKPRRGEGGSHLGGEAPSYGGGKEHPLARLWPGASPRGRRGGGRGRGYQGRCGPRHQRSE

Amino Acids from 3' Exons

DSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHE,TLLNVPRRQKTLKERRRRQPPWRLRGPFLWRWKRIAPPLSPALAGGLPKRKKRRRMKRKRLPRKMLRPQASEIMR,LSTSQGGRKPRRGEGGSHLGGEAPSYGGGKEHPLARLWPGASPRGRRGGGRGRGYQGRCGPRHQRSE