McDonnell Genome Institute

Washington University

CircRNA

chr1|156317165|156321025|-|CCT3|ENST00000295688.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9974

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

22

Peptide

KTDNNRIASIPVDISDSDMMLNIINSSITTK

Amino Acids from 5' Exons

ILSTTLCGPISQPSAESGRQTIIALL,FSSALPYAGQYHSHPQSPEDRQSHC,LAQHYLMRANITAIRRVRKTDNNRIA

Amino Acids from 3' Exons

YPSRHQQYDAEHHQQLYYYQSHQSVVIFGLQHCPGCCQDGTVGEWSERDHKKICKSGK,IPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEK,SQSTSVTVICTSSTALLLPKPSVGGHLWLATLPWMLSRWYSLRRMVGKRLTKNMQEWK