McDonnell Genome Institute

Washington University

CircRNA

chr1|156134402|156137028|+|LMNA|ENST00000347559.6

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9879

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

6

Peptide

AGQVVTLEAALGEAK

Amino Acids from 5' Exons

LEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSE,LRQPVRPRSNFRMRCCGGWMLRTGCRPRRNWTSRRTSTV,GSPRGQEATSGDAAAGGCEQAADHEGGTGLPEEHLQ

Amino Acids from 3' Exons

DQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVT,TSPWAIGRSSARMEMIPCLTGSHQSSPRLGRW,PVHGQLADQAPEWRSLADLPVPTKVHPEGWAGGD