McDonnell Genome Institute

Washington University

CircRNA

chr1|156134402|156136121|+|LMNA|ENST00000347559.6

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9657

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

LLEGEEESLR

Amino Acids from 5' Exons

LEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSE,LRQPVRPRSNFRMRCCGGWMLRTGCRPRRNWTSRRTSTV,GSPRGQEATSGDAAAGGCEQAADHEGGTGLPEEHLQ

Amino Acids from 3' Exons

LAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEE,WQPRRRSFETWRTHWPVSGTPAGGCWRKRSGRWPRCGQGCSSSWTSTRSFWTSSWPWTWRSTPTASSWRARRR,GSQGGEASRPGGLTGPAGHQPAAAGGKGAGDGRDAGKDAAAAGRVPGASGHQAGPGHGDPRLPQALGGRGGE