McDonnell Genome Institute

Washington University

CircRNA

chr1|155756957|155777820|-|GON4L|ENST00000271883.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9002

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

14

Peptide

IMIRFEEPLANLLNEQHR

Amino Acids from 5' Exons

FDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDK,LMALKKWPCLMWKKRRSLPRYPQPQRTRGKKRSGSKIMI,WLRSGPACGRRGGASQDTHSLKEQEEKRDRGPKS

Amino Acids from 3' Exons

VGTTGQPVKTTSDSEGAITAEDEEIFSQTAAGSREGTPEESSSDSDSGPSTEEETPAADAA,FEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQ,LRNHWPTCMNNIGQRSYLNSRRNLQPNSCRKRRLNPRVRKFIRLFWTQHRGRDSSSRCS