McDonnell Genome Institute

Washington University

CircRNA

chr1|155668626|155670464|-|YY1AP1|ENST00000347088.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

HFEGTEFLNPLISK

Amino Acids from 5' Exons

FVSFRTEAFRDVSPSNQQVPSNLQDCPPTDSENQEPQHEQSSQHH,LLALGLKHFEGTEFLNPLISKYLLTCKTARQLTVRIKNLNMNRAPDNIIK,CLDSILKGLSFLTLSASTFPARLPANQESRTSTTELLTTSL

Amino Acids from 3' Exons

PMNFPVCQSKWLGSWPQARFSCIQSYFQCVPRQRIPRIRSSSPRLRT,QISLFAKASGLDPGHKQGFHVSRVTSSVFPEGKESPGDPLHQGGQ,NEFPCLPKQVAWILATSKVFMYPELLPVCSLKAKNPQDKILFTKAED