McDonnell Genome Institute

Washington University

CircRNA

chr1|154990338|154992786|+|FLAD1|ENST00000292180.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

GYNLQMLEAEGSMK

Amino Acids from 5' Exons

VSADVGSGQHEAGPGTAGTAPPAGGCPYGHPPDPLLLPLPFQPHPRLARIHAHQPTA,YNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL,IICRCWKLRAASRPWVNCRHGTPSWRLSLWAPAGLTPTPVASALSAPLTQAGPHSCASTHC

Amino Acids from 3' Exons

DWTYRDIWDFLRQLFVPYCILYDR,TGPTETSGIFCVSCLSHTVSCMTE,LDLQRHLGFSASAVCPILYPVPR