McDonnell Genome Institute

Washington University

CircRNA

chr1|154951231|154951921|-|PBXIP1|ENST00000368460.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9952

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

15

Peptide

AEPASGDTGPGIQDGPR

Amino Acids from 5' Exons

GTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLEGQSPPQSLPSTPKA,APWKVMFVVWSLLAQETQSRETCRRPPWQAWDQTHRTWKARALHRACLQPPKQ,HPGRCLWCGASWPRRHSSPGRPAGDHRGDRPGTRHTGPGRPEPSTEPAFNPQS

Amino Acids from 3' Exons

SLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGE,ACQWRHWARHPGWTQNLREPCRPLTAPPRQMGKNLGPWMEK,PASGDTGPGIQDGPRIESPAGPSQPLQDRWERISWDHGWR