McDonnell Genome Institute

Washington University

CircRNA

chr1|154553031|154555532|-|UBE2Q1|ENST00000292211.4

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9466

60

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

QDYLNLLQHLK

Amino Acids from 5' Exons

DTEDLDHYEMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQDYLN,TQKTITMKKRKSQLRARNLKMMALEKKTWPSRKLKRTRGKIT,HRRLRSLNERGRASGQEIRWHWKRKLGHPRENKEPEARLLK

Amino Acids from 3' Exons

LLQHLKRIISDLCKLYNLPQHPDVEMLDQPLPAEQ,YCSIRGSSPTCVNSITSLSIQMWRCWINPCQQS,IAASEEDHLRPVTLPPSASRCGDAGSTLASRA