McDonnell Genome Institute

Washington University

CircRNA

chr1|154330395|154345545|+|ATP8B2|ENST00000368489.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9069

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

GLMTENTMR

Amino Acids from 5' Exons

KKKGGRGLMTENTMRNSSM,RRKEGAGPRIQEIPVC,EERRARANDREYNEKFQYA

Amino Acids from 3' Exons

RLTLVWGSVGRKGSRLSWPPITPSPSSSSCSASCWCMGAGPTCECASFFAISSTKTLLSPWSTSGLASSVASQP,GSHWCGDQWAGRDPGCLGLRLLLLPVQVPAAPPAGAWALVLPANVQVSLLFLLQKLCFHHGPLLVWLLLWLLSP,AHIGVGISGQEGIQAVLASDYSFSQFKFLQRLLLVHGRWSYLRMCKFLCYFFYKNFAFTMVHFWFGFFCGFSAQ