McDonnell Genome Institute

Washington University

CircRNA

chr1|154234590|154259030|+|UBAP2L|ENST00000343815.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.928

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

10

Peptide

LQMLQTRFPLHSWEMVGKK

Amino Acids from 5' Exons

HSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGRE,IPGRWSGRRRESQARRMVARRNPMRKAKKIETGTETIVGDVVGHQDGGEVPAVDES,FLGDGREEEGSLRPEGWWPDGIQGRQRKSRPGQRLSATWWATKTGERCQPWTR

Amino Acids from 3' Exons

PQVYGYDDLQMLQTRFPL,HKYMVMMTCRCFRQDFH,TSIWLLADASDKISI