McDonnell Genome Institute

Washington University

CircRNA

chr1|153811730|153813452|-|GATAD2B|ENST00000368655.4

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9191

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

3

Peptide

LSNFAQAPQLSVPGGLLGMPGK

Amino Acids from 5' Exons

APQPQSSLQRGIPTSARSMLSNFAQAPQLSVPGGLLGMP,LHSPRAASSVAYPHLPAPCFQTLHRHPSCLCQVASLVCQ,STAPEQPPAWHTHICPLHAFKLCTGTPVVCARWPPWYA

Amino Acids from 3' Exons

AKAVPHFCGLNPLYVPSAAQISPLTGSKKRMVRFYVSSVPPTRKRLKLNTPTGKMHLKPYSRN,QKLCLTSAGTLCMCPVPHRFHPSLEARKEWDSMAVYDLQPEKGSKSTHQPAEKCICESPTAGT,KSCASLLRVEPFVCAQCRTDFTPHWKQEKNGKILCEQCMTSNQKKALKAEHTNRLKNAFVKALQQEQ