McDonnell Genome Institute

Washington University

CircRNA

chr1|151814573|151815425|-|RORC|ENST00000318247.6

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

23

Peptide

SAETAAAAATAATGTSGQDPSSR

Amino Acids from 5' Exons

STWCRASASPTGRHASCGWRTCCGSAPTSSPGRKLATRG,APGAERLQVLQGDMPAAAGGPAAAALQHLLPGGSDWLPEE,HLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRK

Amino Acids from 3' Exons

LSSSAACPRSRGTACMQKCRNSCSSGNSSNRNQWSRPLQQGPKEQIPSPTPWGSQTGSCPWAPRLTCLRLLPVPLASKPQALGPHIPTTWPRQGSMGPHATLNTALSGARLRAERASIAQAASPLTDVDFVLRNTGILGLGNWDRAQTATAAPVSAAHRRHPMPPQR,CQVRPHVQEAEGQPACRSAETAAAAATAATGTSGQDPSSRGPRSRYPHLHLGAPRRAAAPGLLAPAGFCLSPWPPESLRLWALIFQQLGQGRAQWGLMPPIQPAGQGGQRELLHRQPADPPMWTSFGTQASWAWGTGTGPRQLRQPQFPQHTGGTLCLPDRD,VKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEI