McDonnell Genome Institute

Washington University

CircRNA

chr1|151683355|151692584|+|SNX27|ENST00000368838.1

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

11

Peptide

LHACTEEGQLEAVDDVK

Amino Acids from 5' Exons

AVDDVKKGYIKAEEKSYQLQKLYEQRKMVM,QSMMRKVTSKQKKSPINYRSYTNKEKWS,SRCEERLHQSRRKVLSITEAIRTKKNGH

Amino Acids from 3' Exons

YLNMLRTCEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLE,TSTCGLVRATMKSSFPTVPVTPGGRGTLSQPSASRTLNCMPALKKDSW,PQHAKDLGLQNHLSPLCLLQEEGARYHSHQHHALTACLHRRTAG