McDonnell Genome Institute

Washington University

CircRNA

chr1|151638887|151668635|+|SNX27|ENST00000368841.6

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9206

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

TMTLLLPTSFIR

Amino Acids from 5' Exons

EPRECGGDTQAGGGPDSSRREGIDLDSVICTSSGRPRSQRLVGTIILLHRKASSAHIGPQIQTCGAEWEVC,NHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPRYKHVEQNGEKFV,TTMLRGRHTSRWWTFEQARRNSQCYLYLLMRQITIPVTTRWDNHFMITQKSKQCPYRSPDTNMWSRMVRSL

Amino Acids from 3' Exons

YVNWHLMSFLTNSTFRIIHQLCQAPAPFESGFLQQKKKFSMTMTLLLPTSFI,TIGTVSSQTLHSELYISCARHLLDHSKVAFYNRRRNSLKQPCCYLLLSS,RKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQ