McDonnell Genome Institute

Washington University

CircRNA

chr1|151518505|151520691|+|CGN|ENST00000271636.11

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9882

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

1

Peptide

MEQAPNMAEPR

Amino Acids from 5' Exons

DSSYLWSRHPTWLSPGAPTMESRFASSQSQVVQRWALYVEVDDAQLRMQEPVPTGLLCVCRESLGSPLWCSTVGRKAVTPLGSKSRGPMTKGPQELAQIWNSLRTPTLRSRDFLPPRRAAHLMRSLGPTGMESYSVPTPRPHWQALAQWILVTEATACWSPRKWLPQVAPLTLLPCLQWTHSSTSLTVNLEARPGVGLAAEHGCYPLNSANGARAWTAASHGTPLRNGSASPPTTGPLAQNMTTMWALRSSQPRARTVLSVALAVLVRLRTGSFRVLRSRGGVHRTPPCC,TPPIYGAGTQHGAPGPRRPWSPDSLHHRASEWCRDGHSTSRWTTPSGCKSQYLRGCCACAGNRWAALCGAQQWGERRLLWGPNQGGQPRGLRSSELRFGTPEPLLSGQGISCPLAEQHIGAWGLLEWKATPFPLPGLTGRPWPSGSQKQQHAGASPESGFPRHHHCSPVFSGLTHQQVQSTWRPGPGSDWPPNTDATPTAQTEQEPGQPPPTGHLGTGAPVHQPLDLHKIQPCGHFEAASPEPEPESSQWLPFSSDSGLGPSEFGAAEECTGPHHAA,LLLFMEQAPNMAEPRGPVDHGVQIRFITEPVSGAEMGTLRRGGRRPAKDARASTYGVAVRVQGIAGQPFVVLNSGEKGGDSFGVQIKGANDQGASGALSSDLELPENPYSQVKGFPAPSQSSTSDEEPGAYWNGKLLRSHSQASLAGPGPVDPSNRSNSMLELAPKVASPGSTIDTAPLSSVDSLINKFDSQLGGQARGRTGRRTRMLPPEQRKRSKSLDSRLPRDTFEERERQSTNHWTSSTKYDNHVGTSKQPAQSQNLSPLSGFSRSRQTQDWVLQSFEEPRRSAQDPTMLQ

Amino Acids from 3' Exons

MVSSGSTKAVAGQGELTRKVEELQRKLDEEVK,WFLLVLLRPWQGRVSLPEKWRSYSESWMKR,GFFWFYGRGRAGAYPKSGGATAKAGRGE