McDonnell Genome Institute

Washington University

CircRNA

chr1|151406910|151408828|-|POGZ|ENST00000271715.6

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9713

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

25

3

Peptide

LLPLWAMLWPSIWYSTPLTDPAASCHGK

Amino Acids from 5' Exons

WNQAGLHFMYLCYLCGRCYGQAFGIQPLSQIQQHPAT,GIKLACTSCTFVTSVGDAMAKHLVFNPSHRSSSILPR,ESSWPALHVPLLPLWAMLWPSIWYSTPLTDPAASCHG

Amino Acids from 3' Exons

KRNVYHCNKCRLQFLFAKDKIEHKLQHHKTFRKPKQLEGLKPGTK,REMFITATNAGCSFSLPRTKLNTSFNTIKPSVNPSSWRANQAP,EKCLSLQQMPAAVSLCQGQNTQASTPNLPTQAAGGLETRHQ