McDonnell Genome Institute

Washington University

CircRNA

chr1|151266003|151266439|+|PSMD4|ENST00000476855.5

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

20

Peptide

AAAASAAEAGIATTGTEGER

Amino Acids from 5' Exons

ALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEGERGGIRSPGTAGCTLKAGCRHCRESVEVQGRNMWEGWARNGLGGWPVWIWHQFYPAPLFLFPDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGA,PFVYLWKSSGSGRRRRPGGQLQLLLLRPGLLRLGLKVKEVESEVLGLRDAKHKLGVGTAGRVWRSDRVGICGRAGLGMALEAGLCGYGTNSTLLLFSFSQTQTMPCRPSASKSLAALGFLTAVLRKSRLLMPCRCPCREQ,PSCIYGRAAAAAGGGGPAGSCSFCCGRDCYDWDRKRWNPKSWDCGMLNIESWVALQGECGGLTGEYVGGLGEWPWRLACVDMAPILPCSSFPFPRLRRCPAEDDHQPARVWPHWASPKQYDGRADCLCHADVPAGS

Amino Acids from 3' Exons

ALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEGERGGIRSPGTAGCTLKAGCRHCRESVEVQGRNMWEGWARNGLGGWPVWIWHQFYPAPLFLFPDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGA,PFVYLWKSSGSGRRRRPGGQLQLLLLRPGLLRLGLKVKEVESEVLGLRDAKHKLGVGTAGRVWRSDRVGICGRAGLGMALEAGLCGYGTNSTLLLFSFSQTQTMPCRPSASKSLAALGFLTAVLRKSRLLMPCRCPCREQ,PSCIYGRAAAAAGGGGPAGSCSFCCGRDCYDWDRKRWNPKSWDCGMLNIESWVALQGECGGLTGEYVGGLGEWPWRLACVDMAPILPCSSFPFPRLRRCPAEDDHQPARVWPHWASPKQYDGRADCLCHADVPAGS