McDonnell Genome Institute

Washington University

CircRNA

chr1|151088469|151093386|+|GABPB2|ENST00000486076.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9213

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

VSCGYIGDNCK

Amino Acids from 5' Exons

FSKLRVSCGYIGDNCK,FPNESPVDIVIIV,FQIESLLWIYRL

Amino Acids from 3' Exons

NGADVNAKDMLKMTALHWATERHHRDVVELLIKYGADVHAFSKFDKSAFDIALEKNNAEILVILQ,MVQMMPRTCRQLCIGPQSATIEMSSYLSNMELMSMLSANLINQPLTLWRKTMLRFWSSS,WCRCECQGHAEDDSFALGHRAPPSRCRRVTYQIWSCPCFQQIISLHSSGEKQCDFGHPP