McDonnell Genome Institute

Washington University

CircRNA

chr1|150960562|150962158|+|SETDB1|ENST00000271640.9

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

1

Peptide

SPMMIAQMITSVR

Amino Acids from 5' Exons

AKSQMTLQTRRVWKWVMSTLQIWTISRAWRTSKKDMRVMPPVPLTAVVTRTRKMATAVQRTLKSPMMIAQMITSVRMRTSAPVQCGGAMLPGGRPGARKRTDSLRQLPRTPTPQILDPHIFLFLPQSLVAAIHLPPKRHPRTRWPHGAAIVSVKVVLLTLIAIHPSRLMKVGRAGLGEAEWRLRRPPPQDASRMRETSNRPRK,QNPDRLCRQGGSGNGVLCKSGPYRERGELQRRIECPLFLQQWCRLEGPGRWQQRYRGPRVQLRLLGGLQHQFSVAELCYPEADPGPERERTLDNFQGLPPPRSWTPTYSCSSLNPCRWLQSTFLRRDTQEQGGLMVELQCQRWFCLPFILQDRWGGPGWGKPNGGEGLHLRTRHQGGRHQTGQER,KILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPVPPSIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRMEAEKASTSGLGIKDEGDIKQAKKE

Amino Acids from 3' Exons

DTDDRNKMS,TLTTETRCQ,HRPKQDVS