McDonnell Genome Institute

Washington University

CircRNA

chr1|150942562|150947012|+|SETDB1|ENST00000271640.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9437

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

5

Peptide

TRPNMGTLSQMSGELSK

Amino Acids from 5' Exons

EPVRCLENAKMVTSACEFWARRELRLGTKAPLLPSRQL,NLESDVWRTKQRWPDSQHANSGQEENDLAQRHPYCHPDS,TLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTV

Amino Acids from 3' Exons

DDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRPNM,MTKDVSGSIEALHGWSPCSAKHPQPLHWRRSKDSSGHVQIW,QKMVDLSRLYTAGAHVQHENILSLCTGEEARTAQDTSKY