McDonnell Genome Institute

Washington University

CircRNA

chr1|150817081|150836493|-|ARNT|ENST00000354396.6

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9688

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

IEIQDFQK

Amino Acids from 5' Exons

VVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINA,WFSLQPQDQNTASPLRSQMVYLPRIEIQDFQKSITTSMR,GSACDNHRTRTQQAPEVRWFICPGRSKIFRNLSQHQC

Amino Acids from 3' Exons

ELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALT,NNISWRQQMAFCLLSHVRQAGWCMCLTPLLFTSHSLNGLAAHSMIRCTQMMWINFVSSFPLQKMPQ,TETFDLGGSRWLSVYCLMDRQGGVCVLRDSCFEPATVMVWQHTLSGAPRCGTSAAFHFRKCPD