McDonnell Genome Institute

Washington University

CircRNA

chr1|150441880|150457570|+|RPRD2|ENST00000369068.4

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9367

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

IIGTTFK

Amino Acids from 5' Exons

VPLSKLRSSKKITNNRISSGRNHK,YHFQNSEAAERKSEQTTEAVEEIT,TTFKTQKQLKENLNKQPNKQWKKSQ

Amino Acids from 3' Exons

AYKTFANRVNNLKKKLDQLKSTLPDPEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDNRDVEDMELSDVEDDGSKII,HIKPLLTETIRRSWINSQPFQILKNHQFLPQAWTLPPRLVLSLLFREWEVRNPSHQPWRVRNLPHLNLQIIVMWKTWNSQMWKMMGQKSL,INLCPSKQFKEEVGSIEVNPSRSRITSSFPKHGRSLPDWFVSFSGNGRGIPVTNHGEEICHTTCDRSCGRHGTLRCGRWVKNH