McDonnell Genome Institute

Washington University

CircRNA

chr1|150440922|150457570|+|RPRD2|ENST00000369068.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

IIGIHLSLSL

Amino Acids from 5' Exons

GSICLVCRTNLNLGRKCIPRRNDCGIERSF,DPSVSKSVERIFKIWEDRNVYPEEMIVALREAL,IHLSLSLNESLKSGKIEMYTQKKLWHEKL

Amino Acids from 3' Exons

AYKTFANRVNNLKKKLDQLKSTLPDPEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDNRDVEDMELSDVEDDGSKII,HIKPLLTETIRRSWINSQPFQILKNHQFLPQAWTLPPRLVLSLLFREWEVRNPSHQPWRVRNLPHLNLQIIVMWKTWNSQMWKMMGQKSL,INLCPSKQFKEEVGSIEVNPSRSRITSSFPKHGRSLPDWFVSFSGNGRGIPVTNHGEEICHTTCDRSCGRHGTLRCGRWVKNH