top of page

McDonnell Genome Institute

Washington University

CircRNA

chr1|15043988|15044159|+|KAZN|ENST00000361144.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9252

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

8

Peptide

ELEAELAMESEDAVK

Amino Acids from 5' Exons

ESEDAVKALAKEKDLLEREKWELRRQAKEATDHATALRSQLDLKDNRMKELEAELAM,RARMRSKRWPRRRTCWSVRSGSCGAKPRRPQTTPRHCAPSWTSRTTGRSWRPSWP,ERGCGQSAGQGEGPAGAEVGAAAPSQGGHRPRHGTALPAGPQGQPDEGAGGRAGH

Amino Acids from 3' Exons

ESEDAVKALAKEKDLLEREKWELRRQAKEATDHATALRSQLDLKDNRMKELEAELAM,RARMRSKRWPRRRTCWSVRSGSCGAKPRRPQTTPRHCAPSWTSRTTGRSWRPSWP,ERGCGQSAGQGEGPAGAEVGAAAPSQGGHRPRHGTALPAGPQGQPDEGAGGRAGH

bottom of page