McDonnell Genome Institute

Washington University

CircRNA

chr1|150340397|150344547|+|PRPF3|ENST00000467329.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9931

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

12

Peptide

EDISQGVHISVYSTEENPK

Amino Acids from 5' Exons

YRGKSQERRLFWNHKSCTSSPAQSS,TEENPKREDYFGITNLVEHPAQLNPP,QRKIPREKIILESQILLNIQPSSILQ

Amino Acids from 3' Exons

PCLSSMPFSLVDVLPVTTERMKRPTLPENSQQNRERSRKLKSLKKTFHRGYTYLYI,PASDLQCLSHLWMSFLSRQSARGQRCPKTHSRTEKGQENKARRHFTGGTHICI,LPLIFNAFLTCGCPSCHDRAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVY