McDonnell Genome Institute

Washington University

CircRNA

chr1|149950093|149967521|-|OTUD7B|ENST00000417191.2

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9865

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

DSGGEEK

Amino Acids from 5' Exons

GGEFGACIEPRVSRLCPCSCAEAHSRRGRHHAEGLRRG,VESSEEPVYESLEEFHVFVLAHVLRRPIVVVADTMLRDSGGE,WRVLRSLYMRALKSFTSLSLLMCLGGPSSWQTPCGTPEGK

Amino Acids from 3' Exons

KNACLGASPTPAPALFPWPGPMSPPMVGVGGAMSTPWKCPSVPSSFQISLYTMKTSAASRETSLSSPCWLPWNRQ,KTPVGHLPRQLQHCFPGPVPCLLQWWGWGEQAPPGNAHLCLPASRSHCIQRLPQLHRERPHAVHAGCLGTG,KRLSRGISHASSSIVSLARSHVSSNGGGGGSNEHPLEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLVALEQA