McDonnell Genome Institute

Washington University

CircRNA

chr1|147264421|147280191|+|CHD1L|ENST00000369258.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9412

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

ASGSLMPCLQQK

Amino Acids from 5' Exons

FSVVFSLLLTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESES,SQSSVSCPELPSRTASKSSTPSSVLWSLISFPRKRWEILFNATRILRKNLSQ,LSSLQSPVDRNSHPEQPPRALLPPQFCGASLFQGRGGRFYSTLPGYERIV

Amino Acids from 3' Exons

LSEILKFGLDKLLASEGSTMDEIDLESILGETKDGQWVSDALPAAEGGSRDQEEG,VRYSNLVWINCWPLRGAPWMKTWSPSWEKQKMASGSLMPCLQQKEGAEIKRKE,EDTQIWFGTAGLGEHHGNRPGVHPGRNKRWPVGLCLACSRRREQRSRGR