McDonnell Genome Institute

Washington University

CircRNA

chr1|145826453|145836574|+|POLR3C|ENST00000334163.3

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9594

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

LLADDPVK

Amino Acids from 5' Exons

VKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETME,RKPCVSSSNITWVIKCTNVVWWSMKPSAAGYCECLDIPGTSILPKLCTVTLESLLRSFCTANQCQLLRKWQTGSQRPWR,EESPVCPRPTPGELSSAQTWCGGVSPVQPGIANAISPVHLYYQNSVQHWRADCGASVERQTDNVSCCEESGRPAHRDHG

Amino Acids from 3' Exons

IFRSLPVGYNISKQVLDQYLTLLADDP,SSDPYLLAITSLSKFLISISLCWQMI,LQIPTCWLHLASSSVSHSAGRS