McDonnell Genome Institute

Washington University

CircRNA

chr1|145623612|145643978|+|GPR89A|ENST00000313835.13

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.984

57

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

SVTTSASGSEMHK

Amino Acids from 5' Exons

CINNDCFFPVSYGPLCISSGNEIPFPFSAQNM,ATTTAFFLSLMADLYVFLLETRRSLSHSQPKT,HKQRLLFSCLLWLTFMYFFWKLGDPFPILSPKH

Amino Acids from 3' Exons

DGNGTENNVPEGGSAQTIRFLGNDKKCYHFSIRK,MAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSE,WQWHGEQCSRRGKCITNHQVSGEKVLPLQHQEVK