McDonnell Genome Institute

Washington University

CircRNA

chr1|12362719|12507093|+|VPS13D|ENST00000011700.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.983

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

19

Peptide

AVSTSSGVSIPGPSHQKPMVLMSR

Amino Acids from 5' Exons

VLMSRKAEVDTLIPAWSSLPPVTCIINHLTSLHLHRGNLPGD,YCQERPRSIHYLHGHLCPPLPVRIISQACICTEGICQGT,IDVKKGRGRYIDTCMVIFAPRYLLDNKSSHKLAFAQREFARGQ

Amino Acids from 3' Exons

LHRCGEHQLLRAHLLQSCLLPEKWRLRGSRSHFPRSQIRPLPLPCLQRPWEGVCAGDQESREHEQWSVHPRPLPPEAH,FIAVENIDSYCVLISSKAVYFLKSGDYVDREAIFLEVKYDDLYHCLVSKDHGKVYVQVTKKAVSTSSGVSIPGPSHQKPM,SSLWRTLTATACSSPPKLFTSKVETTWIEKPFSKSNTMTSTTALSPKTMGRCMCRPRKPARAVECPSPAPPTRSP